Protein Info for GFF1975 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: mandelate racemase/muconate lactonizing enzyme family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02746: MR_MLE_N" amino acids 101 to 148 (48 residues), 23.4 bits, see alignment 5.8e-09 PF13378: MR_MLE_C" amino acids 179 to 390 (212 residues), 116.1 bits, see alignment E=2e-37

Best Hits

Swiss-Prot: 77% identical to TARD_BRADU: D(-)-tartrate dehydratase (tarD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 92% identity to aaa:Acav_1434)

MetaCyc: 77% identical to D-tartrate dehydratase (Bradyrhizobium diazoefficiens)
D(-)-tartrate dehydratase. [EC: 4.2.1.81]

Predicted SEED Role

"mandelate racemase/muconate lactonizing enzyme family protein" in subsystem Catechol branch of beta-ketoadipate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF1975 mandelate racemase/muconate lactonizing enzyme family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPPIPSFSTPSRSNMKIVDIAESTRPIKSDIRNAYIDFSKMTLSLVAVVTDVIRDGKPVI
GYGFNSNGRYGQGGLIRDRFRPRVLEADPASLLDETGDNLDPHKVWAQMMINEKPGGHGE
RSVAVGTIDMAVWDAVAKIANQPLYQLLAERYGTGTPNPRVFVYAAGGYYYPGKGLDGLR
KEMESYLERGYSVVKMKIGGASLADDCERIESVLKILGPGQQLAVDANGRFDLKTAIDYG
KAMSQYPLFWYEEAGDPLDYELQAELGKVYAGPMATGENLFSMQDARNLIRHGGMRPDRD
WLQFDCALSYGLVEYLRTLEMLKQHGWSPSRCIPHGGHQMSLAIAAGLGLGGNESYPDLF
QPYGGFPDGVKVEQGYVTLPPLPGIGFEGKSDLISAMRALAS