Protein Info for GFF1972 in Sphingobium sp. HT1-2

Annotation: Homoserine kinase (EC 2.7.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00938: homoserine kinase" amino acids 1 to 311 (311 residues), 371.7 bits, see alignment E=1.5e-115 PF01636: APH" amino acids 27 to 262 (236 residues), 143.8 bits, see alignment E=4e-46

Best Hits

Swiss-Prot: 53% identical to KHSE_METRJ: Homoserine kinase (thrB) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 88% identity to sch:Sphch_1448)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF1972 Homoserine kinase (EC 2.7.1.39) (Sphingobium sp. HT1-2)
MAVYTHVPAEEIDAFLTRYDAGRLVSAKGIAEGVENSNYLLETTGHDGNGHRYILTLYEK
RVDEADLPFFMDLLDHLGARGCLVPRFIADTDGKRLQQLGRRPACLIEFLTGISVTEPTP
AQARACGVALGELHKAAQGFAGERRNALDKDGWHALATKCGDDFDQIAPGLGARVAEELA
FLDAHWPADLPRSVIHADLFPDNVLMLGDEVTGLIDFYFSCTDIRAYDLAVTHSAWCFSN
DGATWHGDRAAAIGAGYAAAHGLTDAERAAFPILCRGAALRFLLTRAYDWINTPADALVT
RKDPLAYLRRMDFYAKADPAELLGA