Protein Info for GFF1970 in Xanthobacter sp. DMC5

Annotation: C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details amino acids 315 to 326 (12 residues), see Phobius details amino acids 335 to 348 (14 residues), see Phobius details amino acids 358 to 383 (26 residues), see Phobius details PF00375: SDF" amino acids 18 to 410 (393 residues), 356.6 bits, see alignment E=9e-111

Best Hits

Swiss-Prot: 64% identical to DCTA_BURM1: C4-dicarboxylate transport protein (dctA) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 76% identity to xau:Xaut_4744)

MetaCyc: 58% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>GFF1970 C4-dicarboxylate transport protein (Xanthobacter sp. DMC5)
MAHTAHAVRRRKPWYQVLYIQVLIGIALAIIVGYLWPAVAVDMKPLGDVFIKLIKMIVAL
VIFCTVVTGIAGMSDLKKVGRVGGKALLYFEVMSTIALAIGIIVANVVRPGAGFNANPAT
LDSAAVKAYAGKAADQSISDFLINIVPNTVVDAFARGDILPVVLISVLFGYVLSHLGDRG
KPVRDTIEAGAHLVFGALNVIMRLAPIGAFGAMAFTIGKYGVASLGPLMMLIGTFYLTGA
IFVVGVLGAVCWWAGFSVLKFLAYIKEEILIVLGTSSSDSALPSLMEKLERAGVPKPVVG
LVVPTGYVFNTDGTSIYMTLAALFVAQATNTDLSFTQQMAIFAVAMLTSKGASGVTGASF
IALVGTLSVVPTIPVAGMALILGIDRFMSEARAVINMIGNGVAAVVVARWEGELDHARFT
AALAGEASPPVAMPEPTEALAVPVLRSEQQA