Protein Info for GFF1962 in Xanthobacter sp. DMC5

Annotation: Electron transfer flavoprotein-ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 PF00890: FAD_binding_2" amino acids 15 to 58 (44 residues), 20.7 bits, see alignment 5.4e-08 PF13450: NAD_binding_8" amino acids 18 to 63 (46 residues), 28.9 bits, see alignment 2.8e-10 PF21162: ETFQO_UQ-bd" amino acids 218 to 311 (94 residues), 145 bits, see alignment E=2.1e-46 PF05187: Fer4_ETF_QO" amino acids 453 to 554 (102 residues), 169 bits, see alignment E=6.7e-54

Best Hits

Swiss-Prot: 58% identical to ETFD_PSEAE: Electron transfer flavoprotein-ubiquinone oxidoreductase (PA2953) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 92% identity to xau:Xaut_2374)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.1

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>GFF1962 Electron transfer flavoprotein-ubiquinone oxidoreductase (Xanthobacter sp. DMC5)
MSAAELPEREGMDYDVVVVGAGPAGLATAIRLKQQAAERGTDVSVVVVEKGSEVGAHILS
GAVVDPIGLDALIPGWREEADAPLTVQVTDDHFYLLGPAGGVKLPNFAMPPLMNNHGNYV
GSLGNVCRFLAQKAEALGVEIYPGFAADEILYDDTGAVIGIATGDMGVDKTGEQKPEFTR
GMELRGRYTVFAEGARGHLTKKIIAKYNLGEGRDVPKFGIGLKELWKVKPEKHKPGLVQH
AFGWPLDSKTGGGAFLYHIDDEQVVVGFVVHLNYQNPWLSPFDEFQRFKTHPLFKDTFEG
GKRISYGARAITEGGWQSVPKLSFPGGVLVGCAAGFVNVPRIKGSHNAVLSGMLAADHLL
DALAAERSHDELSSYEAAWRSSAIGADLKKVRNMKPLWSKFGTFLGIPLGALDMWTNTFG
FSLFGTLKHGKSDAASLKPAKDCKKITYPRPDGVLTFDKLSSVFLSNTNHEENQQVHLVV
KDMALQKASEHDIYAGPSNRYCPAGVYEWIEEGADAPRFQINAQNCVHCKTCDIKDPNQN
ITWTAPEGGGGPNYPNM