Protein Info for GFF1962 in Sphingobium sp. HT1-2

Annotation: Twin-arginine translocation protein TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 72 to 99 (28 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 12 to 234 (223 residues), 225.5 bits, see alignment E=3.6e-71 PF00902: TatC" amino acids 14 to 229 (216 residues), 249.8 bits, see alignment E=1.2e-78

Best Hits

Swiss-Prot: 51% identical to TATC_MAGMM: Sec-independent protein translocase protein TatC (tatC) from Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 89% identity to sjp:SJA_C1-28080)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF1962 Twin-arginine translocation protein TatC (Sphingobium sp. HT1-2)
MIGEIDDSKAPLLDHLIELRSRLLKCVYALFITGGICFYFSEQLFAILVHPLKEAFGDAG
GKLVYTKLYEAFFVQIKIAAFGAFCLSFPIIANQLWAFVAPGLYAKEKKALLPFLIATPF
LFALGASLAYFVVMPTAFHFFLGYQGNASGLQIEALPSADSYLGLVMQFILAFGICFLLP
VLLMLLNRAGFVSREQLKGMRRYMIVGAFILAAVLTPPDVVSQLMLAIPLLLLYEITLVA
IWFTDRSQAKRAAAEAAAEEVSA