Protein Info for GFF196 in Variovorax sp. SCN45
Annotation: Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.
KEGG orthology group: K14578, naphthalene 1,2-dioxygenase system ferredoxin subunit (inferred from 97% identity to vpe:Varpa_2937)MetaCyc: 66% identical to 2,4-dinitrotoluene dioxygenase complex ferredoxin component (Burkholderia sp. DNT)
RXN-8820 [EC: 1.14.12.24]
Predicted SEED Role
"Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-)" (EC 1.-.-.-)
MetaCyc Pathways
- 2,4-dinitrotoluene degradation (2/7 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.14.12.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (106 amino acids)
>GFF196 Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-) (Variovorax sp. SCN45) MSTMTWVDAAAVDDVPSDDVVGIEVQGRDIALYGTEDGIHATDNICTHGHARLCDGFLEG HEIECPLHQGRFDVRTGKAMCAPLTEDLRSYPVKIEGGRVFLAFDQ