Protein Info for GFF1950 in Sphingobium sp. HT1-2

Annotation: Phospho-N-acetylmuramoyl-pentapeptide- transferase (EC 2.7.8.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 37 to 357 (321 residues), 414 bits, see alignment E=2.5e-128 PF10555: MraY_sig1" amino acids 68 to 80 (13 residues), 24.1 bits, see alignment (E = 1.8e-09) PF00953: Glycos_transf_4" amino acids 99 to 281 (183 residues), 113 bits, see alignment E=1.4e-36

Best Hits

Swiss-Prot: 78% identical to MRAY_SPHWW: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 96% identity to sch:Sphch_1426)

MetaCyc: 53% identical to phospho-N-acetylmuramoyl-pentapeptide-transferase (Escherichia coli K-12 substr. MG1655)
Phospho-N-acetylmuramoyl-pentapeptide-transferase. [EC: 2.7.8.13]

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF1950 Phospho-N-acetylmuramoyl-pentapeptide- transferase (EC 2.7.8.13) (Sphingobium sp. HT1-2)
MLYWLAQTLDFAGAFNLIRYLSFRAGAAIATALIIGLVIGPKFIGWLRVRQGKGQPIRSD
GPQSHLAKRGTPTMGGLMILTSMVVSVLLWMDLSSTYVWACLFVTLGFGAIGFLDDYDKV
TKASHKGLSAKMRLAFEFLIAGFAAWMIVNQHGNTALYVPFYNGPAIELGPFYFLFAAFV
IVAFGNAVNLTDGLDGLATMPVIIACMAFMAIVYLVGRADFATYLGIPHVPGAGNLTILC
GAIIGAGLAFLWFNAPPAAVFMGDTGSLALGGTIGVIAVTAHHEIVLGVVGGLFVVEALS
VIIQVFFYKRTGKRVFKMAPIHHHFEQLGWAEPTVVIRFWIISFVLALAGLATLKLR