Protein Info for PS417_00985 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 344 (320 residues), 105 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 92% identity to pfs:PFLU0207)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TU67 at UniProt or InterPro

Protein Sequence (389 amino acids)

>PS417_00985 MFS transporter (Pseudomonas simiae WCS417)
MTLNKSLAGWGLLVVLGLNLRPILSSISPLLGEIRLATGLSFQSSALLTSLPVVCMGLVA
LVGVRVEAQLGERRGIALGLMMILLACLARWLMGQGSMLLVTALLGGAGVALIQALVPAM
IKREFHHRVPVAMGVYSASLMAGGGLAALLSPVVATHFQQWQAGLGVWLLPALAALLLWA
WLPLGAAKSAKVIPAFKGLRNRRAWLLALYFGLVNCGYMSMVAWLPAYYQQLGWDVLPSG
SLLAFMTIFQVIAALLMPVLAQRGIDRRPLLWISLLAQTLGYLGLLMAPLQFPHLWVALC
GFGLGACFALSLLLTLDHHRDPRQAGQLAAFVQGVGFLINAISPWLTGWLRELTGSFVSA
WVVLTVTAVAMLVVTRVFSPATYRTAPAL