Protein Info for GFF1949 in Xanthobacter sp. DMC5

Annotation: Rhomboid protease GlpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 95 to 255 (161 residues), 91.6 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: None (inferred from 74% identity to xau:Xaut_2361)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF1949 Rhomboid protease GlpG (Xanthobacter sp. DMC5)
VCPRRFSLAARGGGSYVQDVLDRPTYPGTSHREPVFNVPGAVAVLTLGLVLIHAIRVLLL
SEDADIELLTYFAFIPARYTLPDTMFYLPGGIGPKLWTVVTYALLHANWMHLIVNLVWLL
AFGTPVARRFGSGRFVLFCVVTAAAGAGAHYLANPDAIAPLIGASAAISGTMAAAVRFAF
APGGALSSYRTIFSDHQPAGSLKENFSDKRVLIFVGAWFAFNLLFAFGVSLPGTEGAEVA
WQAHIGGFVAGLLLFPLFDPIPRRRRA