Protein Info for GFF1947 in Xanthobacter sp. DMC5

Annotation: Phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 135 (133 residues), 153 bits, E=8.3e-49
• TIGR01455: phosphoglucosamine mutase
  • amino acids 6 to 443 (438 residues), 626.5 bits, E=1.1e-192
• PF02879: PGM_PMM_II
  • amino acids 158 to 255 (98 residues), 65.1 bits, E=1.5e-21
• PF02880: PGM_PMM_III
  • amino acids 259 to 366 (108 residues), 125.6 bits, E=2.1e-40
• PF00408: PGM_PMM_IV
  • amino acids 375 to 440 (66 residues), 57 bits, E=3.3e-19

Best Hits

Swiss-Prot: 92% identical to GLMM_XANP2: Phosphoglucosamine mutase (glmM) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 92% identity to xau:Xaut_2566)

MetaCyc: 52% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
• starch degradation V (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• glycogen degradation I (4/8 steps found)
• starch degradation III (1/4 steps found)
• glycogen degradation II (2/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• peptidoglycan recycling I (7/14 steps found)
• starch biosynthesis (4/10 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Protein Sequence (447 amino acids)

>GFF1947 Phosphoglucosamine mutase (Xanthobacter sp. DMC5)
MSRRYFGTDGVRGRANASLTADLALRVGMAAGLVFQRGDYRHRVVIGKDTRLSGYMIENA
LVAGFTSVGMDVLLLGPMPTPAVGMLTRSMRADLGVMISASHNPFDDNGIKLFGPDGFKL
SDEVEREIEELIDEDLAKRLAKPAEIGRARRLEGVHARYIEYAKRTLPRNQSFEGIRVVV
DCAHGAGYRVAPEALWELGAEVISIGVEPDGMNINRDVGSTSPAALAAKVREVRADIGIA
LDGDADRVMIVDEKGHTVDGDQLMAVIAESFKEDGRLARDGLVATVMSNLGLERHLAGEG
IAMARTGVGDRYVLERMRADGYNVGGEQSGHIILSDYSTTGDGLVAALQVLAVVARQDKP
VSEVCHRFDPLPQILKNVRYLDGAPLENEKVKIAIADAERRLSNHGRLLIRPSGTEPVIR
VMGEGDDRDLVETVVDEVIDALKRAAA