Protein Info for GFF1938 in Sphingobium sp. HT1-2

Annotation: Cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR00065: cell division protein FtsZ" amino acids 13 to 326 (314 residues), 412.8 bits, see alignment E=6.7e-128 PF00091: Tubulin" amino acids 16 to 176 (161 residues), 166.2 bits, see alignment E=1.1e-52 PF12327: FtsZ_C" amino acids 225 to 320 (96 residues), 125.9 bits, see alignment E=6.5e-41

Best Hits

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 86% identity to sjp:SJA_C1-27850)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>GFF1938 Cell division protein FtsZ (Sphingobium sp. HT1-2)
MSIEISPPHVDELKPRIAVIGVGGAGGNAIANMIAASVEGVDFIVANTDAQALNASPAER
RIQLGPQITEGLGAGSRPEIGRAAAEETIITVEQALEGAHMCFITAGMGGGTGTGAAPVI
AKAAREKGILTVGVVTKPFTFEGNRRMKSAESGIDELQKHVDTLIVIPNQNLFLIANPNT
TFKEAFQMADEVLQQGVRSITDLMIMPGLINLDFADVRSVMGEMGKAMMGTGEAEGDGRA
LQAAEKAIANPLLDGVSMRGAKGVIVSIVGGDDMRLMEVDEAANHIRELVDPDANIIWGS
AFNDNLNGKIRVSVVATGIDNEVGSQAAPLTQPFSFASRPAVAVPQAPRPAPVAAPAPAA
PVAAAPAPVAAPEPEALELDVPEAPAPAPIAAPAAEKAPPAFAPARPAAVFSDEDPSQDE
LLLGAEAAEPTAPEAAPKPAQPAPRVATGGTLFERMAGLTRGSEKAPGAEEGTQGLDIPR
FLNRQNNQ