Protein Info for GFF193 in Sphingobium sp. HT1-2

Annotation: Conjugative transfer protein TrbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 2 to 306 (305 residues), 219.7 bits, see alignment E=2.8e-69 PF04610: TrbL" amino acids 37 to 254 (218 residues), 179.1 bits, see alignment E=5.5e-57

Best Hits

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 70% identity to sjp:SJA_C1-29650)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF193 Conjugative transfer protein TrbL (Sphingobium sp. HT1-2)
VNDLNVIDRFLQAFITYIDSGFGLLGPDVGFLTSTLIGIDITLADLFWAMGGEDNVVGRF
LRKILYIGAFAFILNCFSTLADIVFRSFAQAGLTAGGGSLTAGDLLKPGRLAGTGFEAAW
PLLNQASEMVGFTTFFDNFLTIMVLLLAWAIVIIAFFILAVQMFVCILEFKLTSLAGFIL
VPFALWNRTSFLAERVLGNVVSSGIKVMVLAVIVGIGSNFFTEFTDALNGQEPDIAQAMS
LVLASLSLFGLGIFGPTIASGLLSGAPQLGAGAAIGTAAGAGGIAMLAGGAAVGGARLAG
GAALGAIRSGTAMGSGASAAFKIGQETAGKQTIGAGLAGVAQASGNAAKGRASAALGFGE
AASSGRQAAWSALNQNATASSASADAGGGNAGRGETGAPAWARSLRTEQASRHRRQLAIH
ALQQGDRSGGSATPDIKERND