Protein Info for GFF1929 in Xanthobacter sp. DMC5

Annotation: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 5 to 269 (265 residues), 238.6 bits, see alignment E=4.5e-75 PF01790: LGT" amino acids 13 to 264 (252 residues), 273.7 bits, see alignment E=6.3e-86

Best Hits

Swiss-Prot: 62% identical to LGT_RHOPA: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 90% identity to xau:Xaut_2548)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF1929 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Xanthobacter sp. DMC5)
MPTFALPFPAIDPVLIQVGPLAIRWYALAYIAGLVIGWLLARRLVSRPALWGGTSPMTPQ
DLDDALFWATLGVILGGRLGYVLFYNPAFFAENPADIFAVWKGGMSFHGGLAGTLLALVL
FARSRRIPVFSMLDIAAVVAPIGLFFGRLANFINGELWGRPADVPWAIVFPHGGPLPRHP
SQLYEAGLEGIVLFLIMLLVVRSSELKRPGVAAGIFGMGYGVGRIIGEFFREPDVQLGYL
AFGTTMGMWLSVPLVLAGLGLLLYALKRKPAP