Protein Info for GFF1925 in Variovorax sp. SCN45

Annotation: Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00596: Aldolase_II" amino acids 46 to 225 (180 residues), 157.4 bits, see alignment E=1.9e-50

Best Hits

Swiss-Prot: 47% identical to NOVR_STRNV: Decarboxylase NovR (novR) from Streptomyces niveus

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_4474)

MetaCyc: 47% identical to 3-dimethylallyl-4-hydroxyphenylpyruvate oxygenase (Actinoalloteichus caeruleus)
RXN-14670 [EC: 1.13.12.23]; RXN-14671 [EC: 1.13.12.23, 1.13.11.83]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.83 or 1.13.12.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF1925 Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (Variovorax sp. SCN45)
MSAVLSIDRNAPQPLKLNPNPQQKYWFDPVPPRPTVEAERRHRQERLAGAFRLFARFGFA
QGLAGHITARDPELTDHFWVNPLGIHFSRIKVSDLLLVNSKGETVIGDRPLNKAAFAIHA
AIHEHNPKIVAAAHTHSTYGKAWSTLGRKLDTLTQDSCVFHDDVALFDDFTGMVVDSSEG
DRIAHALGDRKGAILKNHGILTAGPTVEAAAWWYIALDNACHTQLLAEAAGKPQPIDAAT
ARHTHGQIGGSEGAIHSFDSLYEGLVEAEPELLL