Protein Info for GFF1924 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 TIGR00368: Mg chelatase-like protein" amino acids 2 to 505 (504 residues), 565.9 bits, see alignment E=3.6e-174 PF13541: ChlI" amino acids 17 to 133 (117 residues), 136.7 bits, see alignment E=1.1e-43 PF01078: Mg_chelatase" amino acids 202 to 404 (203 residues), 303.8 bits, see alignment E=1.6e-94 PF07728: AAA_5" amino acids 226 to 360 (135 residues), 39.2 bits, see alignment E=2e-13 PF00493: MCM" amino acids 300 to 363 (64 residues), 28.9 bits, see alignment E=1.9e-10 PF13335: Mg_chelatase_C" amino acids 413 to 505 (93 residues), 97.2 bits, see alignment E=2.1e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 75% identity to rfr:Rfer_0471)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF1924 MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LVHSRALLGLEARPVCVEVHLANGLPSFTLVGLADTGVKEARERVRSAIANAGLEFPSNK
RITVNLAPADLPKDSGRFDLPIALGILAASGQIDPARLDGWEFAGELSLGGELRPVRGAL
AMSLAAYRQHHERPIRLVLPPGSAEEAALVPQAQVYRARHLLDVVARFLPEREGDTAAAA
PDEAGWAALAPSARATLPSYPDLLDVKGQVAAKRALEIAAAGGHSLLMVGPPGSGKSMLA
QRFAGLLPPMGTLEALESAAVASLAGRFTLDRWGQRPTCAPHHSASAAALVGGGSPPRPG
EISLAHQGVLFLDELPEFPRSALEALREPLESGHIRISRAAMQSEFPARFQLIGAMNPCP
CGFLGHPTRACRDTPDQIARYQGKLSGPLLDRIDLHVEVPTMPPDDLLRGPPGEPSATVR
ERVHLARQRAQARQGTTNQALAGQALDAHVNAEPAALKFLNTAAARLGWSARSTHRALRV
ARTIADLSGVDAVAAAHVAEAVQYRRVLRAG