Protein Info for GFF1923 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02639: DUF188" amino acids 24 to 150 (127 residues), 152.2 bits, see alignment E=3.2e-49

Best Hits

Swiss-Prot: 71% identical to Y4000_AZOC5: UPF0178 protein AZC_4000 (AZC_4000) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K09768, hypothetical protein (inferred from 82% identity to xau:Xaut_2540)

Predicted SEED Role

"UPF0178 protein BR1979"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>GFF1923 hypothetical protein (Xanthobacter sp. DMC5)
MSASREEPIALYIDADACPVKEEAYKVAFRHHIRVLVVANAPLMVPRHPLVERVIVPAGP
DAADDFIAARVSRGDVVVTADVPLASRCVAAGAAVIAPDGRPFTANSIGMQLATRNLMED
LRSAGAITGGPKPFSPRSRSEFLSALDLAIVRLKRAGFRPAPPEAG