Protein Info for GFF1923 in Sphingobium sp. HT1-2

Annotation: Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR00528: glycine cleavage system T protein" amino acids 20 to 380 (361 residues), 310.2 bits, see alignment E=8.6e-97 PF01571: GCV_T" amino acids 21 to 274 (254 residues), 244.7 bits, see alignment E=9.5e-77 PF08669: GCV_T_C" amino acids 303 to 379 (77 residues), 75.9 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 88% identity to sch:Sphch_1413)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF1923 Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10) (Sphingobium sp. HT1-2)
MTATDDVAALEAELPLEALPLDAWHRAKGARMVGFAGYHMPIQYEGIMAEHSWTREHAGL
FDVSHMGQLTFSDETGGASVDAALETLLPSDIKGLKPFRQRYSMLLDQEGGILDDLMVSR
PGDGAFEGAAIYMVVNGATKYDDIGWMIEHLPDDVTMNHMADQALLALQGPEAGEAMAAL
IPETADLIFMQSGPFTWRGVPLWISRSGYTGEDGFEISVPGDSVALLADALCALPQVKPI
GLGARDSLRLEAGLPLYGHDLSPAVSTIGADLGFAIQKRRREEGGFIGHARVMKELAEGP
GSKRVGLKIEGRLPAREGAQIYAGDVLVGEVTSGGFAPTVGAPIAMGWVSLPYSALDTAL
EIEVRGKRIAAAVAPMPFVPHRYRRKA