Protein Info for GFF1914 in Xanthobacter sp. DMC5

Annotation: 50S ribosomal protein L19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR01024: ribosomal protein bL19" amino acids 1 to 117 (117 residues), 162.2 bits, see alignment E=2.2e-52 PF01245: Ribosomal_L19" amino acids 3 to 117 (115 residues), 166.9 bits, see alignment E=6.5e-54

Best Hits

Swiss-Prot: 89% identical to RL19_XANP2: 50S ribosomal protein L19 (rplS) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02884, large subunit ribosomal protein L19 (inferred from 89% identity to xau:Xaut_2510)

MetaCyc: 63% identical to 50S ribosomal subunit protein L19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L19p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>GFF1914 50S ribosomal protein L19 (Xanthobacter sp. DMC5)
MNIIQTLEAEQATKLAEKRAIPEFQPGDTVTVNVKVVEGERTRVQAYEGVVIARSGGGLN
ESFTVRKISYGEGVERVFPVYSPLIDSIKVVRRGKVRRAKLYYLRDRRGKSARIAERQDR
TTDAKGGKKAKVAKAPAAAE