Protein Info for GFF1914 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cell division inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR01777: TIGR01777 family protein" amino acids 3 to 292 (290 residues), 359.2 bits, see alignment E=9.8e-112 PF01370: Epimerase" amino acids 3 to 215 (213 residues), 96.6 bits, see alignment E=3.2e-31 PF16363: GDP_Man_Dehyd" amino acids 4 to 220 (217 residues), 33.5 bits, see alignment E=6.5e-12 PF13460: NAD_binding_10" amino acids 7 to 114 (108 residues), 34.6 bits, see alignment E=3.5e-12 PF08338: DUF1731" amino acids 249 to 295 (47 residues), 64.6 bits, see alignment 1.1e-21

Best Hits

Swiss-Prot: 86% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 99% identity to sed:SeD_A2700)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF1914 Cell division inhibitor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQILITGGTGLIGRHLIPRLLTLGHQVTVVTRNPDNARQILDSRVTLWKGLAEREHLNEI
DAIINLAGEPIADKRWTSQQKERLCQSRWAITQKLVDLIHASATPPSVLISGSATGYYGD
LGDVVVTEDEPPHNEFTHKLCARWEQIACRAQSDQTRVCLLRTGVVLAPQGGILGKMVPP
FRLGLGGPVGNGRQYLAWIHIDDMVNGILWLLDNDLRGPFNMVSPYPVHNEHFAHALGRA
LRRPAIIRIPATAIRLLMGESSVLVLGGQRALPKRLEAAGFAFRWYDLEEALADVIR