Protein Info for GFF1911 in Sphingobium sp. HT1-2

Annotation: Transmembrane protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 11 to 245 (235 residues), 170.1 bits, see alignment E=3.4e-54

Best Hits

Swiss-Prot: 44% identical to YFCA_ECOLI: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli (strain K12)

KEGG orthology group: K07090, (no description) (inferred from 83% identity to sjp:SJA_C1-27690)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF1911 Transmembrane protein YfcA (Sphingobium sp. HT1-2)
MILSPETIAFLMAAAFMAGCIDAMAGGGGLIALPALLAAGVPPVPAVATNKLQSCLGTFG
ACVAYARRGHMDLATYKGPVIAAFIGSIGGAWLLQRVDPSILAGLMPALLIAMAAYFTFS
PKLSDADRHARVGLWGLSGMIGVVGFYDGFFGPGAGAFYTSIFIALGGLSLLRATAQTKA
ANFASNVAGLLTMVAGGHVIWIAGLAMAVGSITGGQIGSHLAMRFGSKLIKPLLIIMSLA
LTTKMLLDPKNPIHIYLFG