Protein Info for GFF1907 in Sphingobium sp. HT1-2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 271 to 287 (17 residues), see Phobius details PF00892: EamA" amino acids 5 to 139 (135 residues), 56.5 bits, see alignment E=1.9e-19 amino acids 157 to 286 (130 residues), 32.2 bits, see alignment E=6.3e-12

Best Hits

KEGG orthology group: None (inferred from 76% identity to sch:Sphch_1397)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF1907 Permease of the drug/metabolite transporter (DMT) superfamily (Sphingobium sp. HT1-2)
MGCAMFGIIASLLFVLIWSTGFIVARAMVPHGAPELILAARLCLTALLLGALALHGRQPW
PRGRRLGLHLAAGAMLHGLYLTLSWWAVSHGMPAGIMSLLGATQPLMVAVASVAILGERL
PARAWSGLAIAILGVGCVLMPAIAKSGAGAITLIPAVAGIVAVLAMTGGTLIQRGTIGGD
PIWVSGAVQNAGGALVAIAATLIVGEWRWDNSPMLWIGLGWSVLGLSAAGLSLLVWLVRT
QGPTRMSMLLLLVPPLAAVEAWLLFGEKLGPVQIAGFALALGGVLLGRSQPKRTEVVEPA