Protein Info for GFF1904 in Sphingobium sp. HT1-2

Annotation: ABC transporter involved in cytochrome c biogenesis, CcmB subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details PF03379: CcmB" amino acids 7 to 211 (205 residues), 148.8 bits, see alignment E=8.1e-48

Best Hits

Swiss-Prot: 49% identical to CCMB_RHOCB: Heme exporter protein B (helB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02194, heme exporter protein B (inferred from 90% identity to sch:Sphch_0084)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GFF1904 ABC transporter involved in cytochrome c biogenesis, CcmB subunit (Sphingobium sp. HT1-2)
MRLIALLVARDLGQAWRSAGLWLPVAFLLLVASLYPFAVGPDAALLARTGGGMLWIAALL
ASLLPVDRLVAPDRDAGILDQIALRGISEEMVVIARLIAHWLGFGPPLMIAALPAAALLK
LDGATILTLEAGLLIGTPALAALGLLVATLTAGLRSSGALAGLLALPLAVPLLIFGAGTL
GDGSGAAFKFLGAASLLLVAITPIAGGAAIRAGRE