Protein Info for GFF1903 in Sphingobium sp. HT1-2

Annotation: ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 24 (1 residues), see Phobius details amino acids 26 to 27 (2 residues), see Phobius details TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 7 to 186 (180 residues), 140.5 bits, see alignment E=2.7e-45 PF00005: ABC_tran" amino acids 23 to 149 (127 residues), 63.1 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 58% identical to CCMA_SPHAL: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 72% identity to sch:Sphch_0085)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>GFF1903 ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA (Sphingobium sp. HT1-2)
MSGAALRLSGLACLRGGRLLFAGVDLVLAAGGSALLHGANGIGKSSLLRQCAGLLPIHAG
TIDRQGSVALADERLALDMELPLHRALGFWARLDRADAAALDRALHAMALAPLRDVPVRM
LSTGQRKRAMLARVIASGADIWLLDEPANGLDDASVALLGAAVADHLAAGGIVVAASHQP
LPLTDPVRIEMAAHVPDPAQEASCD