Protein Info for PS417_00095 in Pseudomonas simiae WCS417

Annotation: peptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR00079: peptide deformylase" amino acids 4 to 161 (158 residues), 185.3 bits, see alignment E=3e-59 PF01327: Pep_deformylase" amino acids 4 to 153 (150 residues), 179.7 bits, see alignment E=1.6e-57

Best Hits

Swiss-Prot: 89% identical to DEF_PSEU5: Peptide deformylase (def) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 99% identity to pfs:PFLU0018)

MetaCyc: 59% identical to peptide deformylase (Escherichia coli K-12 substr. MG1655)
Peptide deformylase. [EC: 3.5.1.88]

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0B0 at UniProt or InterPro

Protein Sequence (168 amino acids)

>PS417_00095 peptide deformylase (Pseudomonas simiae WCS417)
MAILNILEFPDSRLRTIAKPVAVVDDKVRQLVDDMFETMYEAPGIGLAATQVNVHLRVVV
MDLSEDRSEPKVYINPEFEPLTDEMGEYQEGCLSVPEFYENVERPLRVKIKALDRDGKPF
ELIAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKKHRQQA