Protein Info for GFF1898 in Xanthobacter sp. DMC5

Annotation: Elongation factor P--(R)-beta-lysine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00152: tRNA-synt_2" amino acids 27 to 351 (325 residues), 134.2 bits, see alignment E=2.7e-43 TIGR00462: EF-P lysine aminoacylase GenX" amino acids 29 to 351 (323 residues), 371.2 bits, see alignment E=2.3e-115

Best Hits

KEGG orthology group: K04568, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 80% identity to xau:Xaut_2530)

Predicted SEED Role

"Translation elongation factor P Lys34:lysine transferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.6

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF1898 Elongation factor P--(R)-beta-lysine ligase (Xanthobacter sp. DMC5)
MAVSSSSPVPPSPPWWRPDVHADRRPFLLARGRIAAAVRSAFAEDGFIEVETPALQVSPG
NETHLHAFGTDLVGPDGATRRLYLRTSPEFAAKKLLAAGEPKIFEFARVFRNRERGMAHH
PEFTMLEWYRAGAPYTAMMEDCATLLARAAEAGGASAFHYRGKTCDPFAAPERLTLVGAF
ARHAEMDLEALLPAPGAPPDAAAFARTAAEAGIRTAPDDTWGDVFSRVLVEKIEPHLGLG
HPTILTDYPVSEAALARPKPDDPRFAERFELYCCGLELANAFGELTDAEEQRRRFENDMD
EKERLYGERYPLDEDFLAALALMPSASGCALGFDRLALLASGARRIEDVLWAPVAGG