Protein Info for GFF1897 in Xanthobacter sp. DMC5

Annotation: Elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF08207: EFP_N" amino acids 6 to 62 (57 residues), 55 bits, see alignment E=9.4e-19 TIGR00038: translation elongation factor P" amino acids 6 to 187 (182 residues), 209 bits, see alignment E=2.4e-66 PF01132: EFP" amino acids 67 to 125 (59 residues), 82 bits, see alignment E=3.3e-27 PF09285: Elong-fact-P_C" amino acids 131 to 186 (56 residues), 75.7 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 94% identical to EFP_XANP2: Elongation factor P (efp) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02356, elongation factor P (inferred from 94% identity to xau:Xaut_2531)

MetaCyc: 35% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>GFF1897 Elongation factor P (Xanthobacter sp. DMC5)
VVKVIASTLRKGNVVDIDDKLYVVLTAENIHPGKGTPVTQLDMRRISDGVKISERYRTTE
QVERAFVEDRPHTFLYEDSDGYTFMNPENYDQVTVPKDVMGDQSVYLQEGMECMLSTHNG
VPIAIELPARVVLEIVDTEPTVKGQTASSSYKPAVLSNGVRTMVPPHIAAGTRVVVMTAD
ASYVERAKD