Protein Info for GFF1897 in Xanthobacter sp. DMC5

Annotation: Elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08207: EFP_N
  • amino acids 6 to 62 (57 residues), 55.1 bits, E=9.1e-19
• TIGR00038: translation elongation factor P
  • amino acids 6 to 187 (182 residues), 209 bits, E=2.4e-66
• PF01132: EFP
  • amino acids 70 to 123 (54 residues), 75.6 bits, E=3.6e-25
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 75.4 bits, E=3.5e-25

Best Hits

Swiss-Prot: 94% identical to EFP_XANP2: Elongation factor P (efp) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02356, elongation factor P (inferred from 94% identity to xau:Xaut_2531)

MetaCyc: 35% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (189 amino acids)

>GFF1897 Elongation factor P (Xanthobacter sp. DMC5)
VVKVIASTLRKGNVVDIDDKLYVVLTAENIHPGKGTPVTQLDMRRISDGVKISERYRTTE
QVERAFVEDRPHTFLYEDSDGYTFMNPENYDQVTVPKDVMGDQSVYLQEGMECMLSTHNG
VPIAIELPARVVLEIVDTEPTVKGQTASSSYKPAVLSNGVRTMVPPHIAAGTRVVVMTAD
ASYVERAKD