Protein Info for PS417_09635 in Pseudomonas simiae WCS417

Annotation: mannose-1-phosphate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 7 to 479 (473 residues), 572.1 bits, see alignment E=4.6e-176 PF00483: NTP_transferase" amino acids 9 to 294 (286 residues), 165.6 bits, see alignment E=3.8e-52 PF12804: NTP_transf_3" amino acids 10 to 143 (134 residues), 31.8 bits, see alignment E=3.8e-11 PF22640: ManC_GMP_beta-helix" amino acids 303 to 357 (55 residues), 47.5 bits, see alignment 3.3e-16 PF01050: MannoseP_isomer" amino acids 362 to 475 (114 residues), 173 bits, see alignment E=5.9e-55 PF07883: Cupin_2" amino acids 392 to 457 (66 residues), 36.2 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2081)

Predicted SEED Role

"Mannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22)" in subsystem Alginate metabolism or Mannose Metabolism (EC 2.7.7.22)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.22

Use Curated BLAST to search for 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U026 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PS417_09635 mannose-1-phosphate guanylyltransferase (Pseudomonas simiae WCS417)
MNTLNGLIPCIISGGSGTRLWPVSRQNMPKPFMRMRDGQSLLQKTFQRAAKLPGVESVLT
VTNRDLLFRTLDDYRLVNKAHLPLDLLLEPFGRNTAAAIAVAALHVQEHFGGEAQLLVMP
ADHLILNEVAFAEAVTQARDLAEAGYLVTFGIQPDQPETGFGYIEQGERLGTGNRVKRFV
EKPDLATAQAYLDGGKHLWNAGMFCFKASTLVDELATHAPDVLEAARAALDHSQSLQNKT
SRQRELDSEAFGSAPDISIDVALMEKSTQVAVVPCDIGWSDIGSWEALRQLTPSDAHGNQ
VNGEAILHDVHNCYIDSPKRVLGAVGVRDLIIVDTPDALLIADAHRSQDVRYIVAELKRQ
NHPAYSLHRTVTRPWGTYTVLEESSRFKIKRIVVKPQASLSLQMHHHRSEHWVVVSGAAQ
ITNGEREFLINANESTYIPAGHKHRLTNPGIIDLVMIEVQSGEYLGEDDIVRFDDIYGRA
PADVKK