Protein Info for GFF1891 in Sphingobium sp. HT1-2

Annotation: Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR01027: glutamate 5-kinase" amino acids 15 to 375 (361 residues), 364.9 bits, see alignment E=2.4e-113 PF00696: AA_kinase" amino acids 16 to 243 (228 residues), 141.9 bits, see alignment E=4.4e-45 PF01472: PUA" amino acids 287 to 357 (71 residues), 75.4 bits, see alignment E=4.1e-25

Best Hits

Swiss-Prot: 66% identical to PROB_SPHAL: Glutamate 5-kinase (proB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 88% identity to sch:Sphch_2996)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF1891 Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA (Sphingobium sp. HT1-2)
VATNALSGFPPALVRRLVIKIGSALLVDPAGEVRVDWLRTLVADVAARKAAGQQVIIVSS
GAIALGARRLKLPKGGRGSLEDAQAAAATGQIALSQCWASLLHEKGITAAQMLVTLDDLE
HRRRYLNASATLERLMALDVVPVVNENDSVATAEIRFGDNDRLAARIGQAARADAVVLLS
DVDGLYTANPHADANAMLIERIERIDARIAAMADTGSASGMGSGGMVSKIQAAQIATGAG
AHLAIISGKVDAPLSHWANGGRGSIFLAAESQGARKGWLSGRLTVLGRIIVDAGAEAALG
KGNSLLPAGVARVEGVFARGDVVDILNQDGRVIARGLTEYDSEAAAKIAGRRSEHIPALL
GEMSRTVLVHRDHMAMV