Protein Info for GFF1890 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 52 to 254 (203 residues), 188.8 bits, see alignment E=4.6e-60 PF00574: CLP_protease" amino acids 79 to 133 (55 residues), 23.6 bits, see alignment E=4.2e-09 PF01343: Peptidase_S49" amino acids 106 to 256 (151 residues), 136.9 bits, see alignment E=5.7e-44

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 85% identity to xau:Xaut_2220)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF1890 hypothetical protein (Xanthobacter sp. DMC5)
MSLDADQIVERRRLRRKVTFWRVLGVLGVVAAVAVGVSALIGRDIPASSPHVARIMIGGI
IRNDRERVELLEEIGRSRASAVILSIDSPGGTVTGSEQLFDALRRLAAKKPVVAVVEGVA
ASGAYIAALGADHIVARRNALVGSVGVIYQFPNFTELLKTVGVTMEDIKSSPLKASPNPY
TPVTPEARAAVDSLVKDSYAWFKDLVGDRRKLSDAKLANVSDGRVFTGHQGLELQLVDEL
GDERTARAWLAREKGVSEALKVRTWRTKEVGDEFGWLLGAARGVVSALGFPQAAALLTDA
AKGALERGQLDGLLALWHPRS