Protein Info for PS417_09590 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 40 to 67 (28 residues), see Phobius details amino acids 76 to 103 (28 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 237 to 243 (7 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 368 to 406 (39 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details PF03023: MurJ" amino acids 28 to 436 (409 residues), 151.5 bits, see alignment E=3.1e-48 PF13440: Polysacc_synt_3" amino acids 77 to 324 (248 residues), 41.7 bits, see alignment E=9e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU2072)

Predicted SEED Role

"Extracellular Matrix protein PslK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UD64 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PS417_09590 membrane protein (Pseudomonas simiae WCS417)
MLGSAAWLTLATLLGLCLGFAREWLLVAAWGAGERSDAFLIALFLPEALRMSLAGGVLSA
AALPLYLARKDDERLGWLAALFPALLLIALVTSLLLTLLAPWLVQLLGPGLAASATALAS
SNLQIVAWCVPGLMLHALFSIPLQASERFVLAGLGSLLFNLPPVTYLALAGTATQPHALA
LACLAGSLLMPLALLPSMWRQGWRPWCWQLPWAPLRELGQRIGPLLLSNGASQGLALIER
LVASLLGEGAVTWVNLARKLMNLPLIALMSLNQVLLGMMSRRQGDERLALLKRGLETASV
LTLPAGVGLVAAAPSLVALLLPAQSLDSPLPLLLAWFAVPLVFGAWNALLARYAYAAGDT
RQPLRCELLGSLVNALLLGVLPFVFGLAGIPLAALAGVICTALLLMQRQALLSALPWARS
WLLNAVLMGVAALALFRIEGVWLQLGLSTLAGAVVLLGMGLWLKPWRKA