Protein Info for GFF1882 in Sphingobium sp. HT1-2

Annotation: Inner membrane protein YbaL, KefB/KefC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 336 to 363 (28 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 16 to 390 (375 residues), 186 bits, see alignment E=1e-58 PF02254: TrkA_N" amino acids 414 to 528 (115 residues), 90.1 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 86% identity to sjp:SJA_C1-27180)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>GFF1882 Inner membrane protein YbaL, KefB/KefC family (Sphingobium sp. HT1-2)
MPHHTPLIGTIVAGLVVAFIMGAIAHRLKLSPLVGYLVAGIMVGPFTPGFVADSGLANEL
AEIGVILLMFGVGLHFSLKDLLSVKAIAVPGAIVQIAVATLLGMGLGYLMGWPLMGGLVF
GLALSVASTVVLLRALQGADLVETRRGRIAVGWLIVEDLVMVLALVLLPALAGVMNNADA
GGGASALIAPLVGTLLKVVGFVVLMLVVGRRLIPWALHWVVHSGSRELFRLAVLAIALGV
AFGAAIVFDVSFALGAFFAGMILGETPLSRRATEETLPLRDAFAVLFFVSVGMLFNPAVV
VEQPLPLLATVLIIVVGKSIAAWGIVRAFGHPNVTALTIAASLAQIGEFSFILASLGAGL
GVLPAEARDLILAGAIVSIFINPILFSLIVRDHKKEEDETQADTATDQPRLGHVILVGYG
RVGKLIAKRLAERHVQFVVIEGDPERVEEAEEAGLSVVRGNALEDRHLLAAGICEARYLL
IAVPEGFEGGAINEHARHLNPNLQVIARAHSDAEVAHLEALGVRHVVMGERELAGRMLQL
CGVG