Protein Info for GFF1877 in Xanthobacter sp. DMC5

Annotation: Glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 121 (119 residues), 150.6 bits, E=1.2e-48
• PF01597: GCV_H
  • amino acids 4 to 121 (118 residues), 147.7 bits, E=7.4e-48

Best Hits

Swiss-Prot: 83% identical to GCSH_XANP2: Glycine cleavage system H protein (gcvH) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 83% identity to xau:Xaut_2200)

MetaCyc: 48% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Protein Sequence (123 amino acids)

>GFF1877 Glycine cleavage system H protein (Xanthobacter sp. DMC5)
MTVRYTKDHEYVRIDGDVAVVGISDYAQGQLGDVVFVELPDIGKSVTRGKEAAVVESVKA
ASEVYAPISGEVVEVNSELEGAPGLVNEDAEGKGWFLKLKIADAAELSELMDEAAYKAFL
DTL