Protein Info for GFF1875 in Sphingobium sp. HT1-2

Annotation: Ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 39 to 67 (29 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 148 to 175 (28 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 26 to 285 (260 residues), 79.7 bits, see alignment E=1.6e-26 PF03631: Virul_fac_BrkB" amino acids 36 to 290 (255 residues), 171.1 bits, see alignment E=1.9e-54

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 36% identity to alt:ambt_02815)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>GFF1875 Ribonuclease BN (Sphingobium sp. HT1-2)
MTETIAQQVHVDAPWKIPPRAWWEILKRVYAAMSANHLGLLSAGVAYYAFLSIAPLLAAV
VLTYGLVGDPQIVARHMQAIITVVPADAAQLINDQLLGMVSARKPAIGFGLFLALGLAVY
GATRAASAIMEALNIVYAQKEGRNIFAFYRVSMGITFSAVLVVVAGVVTATIIGLLQKLL
TNWGPGVLFAIKATTWICAGLLASSIFGLIYRFGPHRRRVQWQWLTVGSIAATLFWLVAT
LGVSFYVSTFGDYNKTYGSLAAVVILQLWLFVSAYIVLLGAQINAEAERQTSAHILVEEV
A