Protein Info for GFF1872 in Sphingobium sp. HT1-2

Annotation: Aspartate carbamoyltransferase (EC 2.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR00670: aspartate carbamoyltransferase" amino acids 22 to 320 (299 residues), 311 bits, see alignment E=3.9e-97 PF02729: OTCace_N" amino acids 22 to 165 (144 residues), 148.4 bits, see alignment E=1.6e-47 PF00185: OTCace" amino acids 173 to 319 (147 residues), 77.4 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 79% identical to PYRB_SPHWW: Aspartate carbamoyltransferase (pyrB) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 94% identity to sjp:SJA_C1-27100)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF1872 Aspartate carbamoyltransferase (EC 2.1.3.2) (Sphingobium sp. HT1-2)
MPDIFIPDATPELTGRALFPHRHLLSIADLKPWEIRFLLDEAEHWARTNKGQARKHDDRL
AGMTQINAFFENSTRTLLSFEIAGKRLGADVVNMAAATSSVKKGETLIDTAMTLNAMAAD
VIVIRHASSGAVALIADKVDCPVLNAGDGWHQHPTQALLDALTIRRRKGGFEGLVVAICG
DVLHSRVARSNMLCLAALGAQVRAVAPPTLLPPEVEMLGATPYSRMEDGLDGADVVMMLR
LQNERMDGAFIPSAREYHALYGLTPERLAIAKPDALVMHPGPMNRGVEITSTVADDPDRS
AITEQVAMGVAVRMACLDVLTRQARGVEGWA