Protein Info for GFF1870 in Sphingobium sp. HT1-2

Annotation: Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF00355: Rieske" amino acids 38 to 120 (83 residues), 68.6 bits, see alignment E=3.6e-23 PF00848: Ring_hydroxyl_A" amino acids 176 to 369 (194 residues), 148.5 bits, see alignment E=2.5e-47

Best Hits

KEGG orthology group: None (inferred from 75% identity to sjp:SJA_C1-27080)

Predicted SEED Role

"Choline monooxygenase, chloroplast precursor (EC 1.14.15.7)" (EC 1.14.15.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF1870 Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit (Sphingobium sp. HT1-2)
MGETGCGPDPDAGYSLPAWTYSDPEFFAVETRRIFRPSWQIVAHDSDLPAPGDFHVLDYL
GESIIVIRGDDGEARAFTNVCRHRGARLVDGPSGRTRKLVCPYHAWTYGLDGCLTGLPMA
GSYGNLDRSRHGLVAIEIENFHGFLFVRLEDDGGPSVAQMMAPYVDEIAPYRFSELRALG
RVTLRPRAVNWKNIGDNYSDGLHIAVAHPGLKRLMGDGYGVEASPYADKMWGPILDRPSA
NLSERAYQHFLPAVPHLPPDRQRLWTYFKLWPNFAFDIYPDQVDFMQWLPVSPTQTLIRE
ISYALPDDRREMKAARYLNWRINRQVNAEDTELVARVQAGMASDSFTVGPLSDQEVALRH
FCARMRTIIPQARQHRAPKMGWSFDYHDSRHSRAGGNPSPDLTYGEMAGDGSPPSRG