Protein Info for GFF1868 in Xanthobacter sp. DMC5

Annotation: Alanine racemase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00492: alanine racemase" amino acids 1 to 331 (331 residues), 216.7 bits, see alignment E=2.3e-68 PF01168: Ala_racemase_N" amino acids 1 to 188 (188 residues), 167.9 bits, see alignment E=2.9e-53 PF00842: Ala_racemase_C" amino acids 200 to 330 (131 residues), 127.8 bits, see alignment E=2e-41

Best Hits

Swiss-Prot: 56% identical to ALR_METS4: Alanine racemase (alr) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 84% identity to xau:Xaut_2403)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1868 Alanine racemase, biosynthetic (Xanthobacter sp. DMC5)
VVKANAYGLGIDRVAPALWKAGARTFFVAHFKEALKLRGLLPEAVIYVLNGLLPETAADH
VAANLRPVLGSVPEITEWSDFCRAQGADLPTAIHVDTGMNRLGLSVDEAVQLAGTRKMLG
FTPSLVMSHLACADTPGHALTARQRAVFADVIRRFRGVPGSLANSAGTLLGRDFRFELVR
PGIFLYGGVAITGVPPLRPAVRLEVKIIQVSNVAAGETVGYGAAERLKRPSRLATVSIGY
ADGLFRAAGSSDLAKGVEAIVAGRRCHLVGRVSMDLATLDITDLPEDAVQRGDVAVFLGD
GISVDDLAARSGTIGYEVLTSLGARYARRYIGG