Protein Info for GFF1868 in Sphingobium sp. HT1-2

Annotation: Sodium/bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details PF13593: SBF_like" amino acids 9 to 314 (306 residues), 317.2 bits, see alignment E=1.3e-98 PF01758: SBF" amino acids 43 to 214 (172 residues), 51.5 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 82% identity to sch:Sphch_2979)

Predicted SEED Role

"Sodium - Bile acid symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF1868 Sodium/bile acid symporter family (Sphingobium sp. HT1-2)
MTRLRLILDPFLVLLLCTVALASVLPARGQGAHVASIVADAGIVLLFFLHGAKLSREAIW
DGAKAWQLHLATLGTTFLFFPLVGILLQQIGAIPENMRAGLLFLALLPSTVQSSIAFTAI
ARGNVAAAVVSASFSNLLGIVLTPLLVALLMQRGGSNLISLSSVEGIMLQLLLPFVLGHL
ARPWIGGFVSRHKTLVGRVDRTSILLVVYSAFSAAVVEGLWHRVSRAELALLALLCIAML
VIVLLFTWGLGRLLGFSREDAIVLQFCGSKKSLASGVPIAGVLFPAAAVGPIILPVMLFH
QIQLMACALLARRYGAQAADRADSQMATIS