Protein Info for GFF1867 in Xanthobacter sp. DMC5

Annotation: Replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00772: DnaB" amino acids 17 to 118 (102 residues), 91.6 bits, see alignment E=4.6e-30 TIGR00665: replicative DNA helicase" amino acids 17 to 484 (468 residues), 520.3 bits, see alignment E=2e-160 PF03796: DnaB_C" amino acids 195 to 482 (288 residues), 345.2 bits, see alignment E=3.3e-107 PF13481: AAA_25" amino acids 202 to 388 (187 residues), 57.7 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 95% identity to xau:Xaut_2404)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>GFF1867 Replicative DNA helicase (Xanthobacter sp. DMC5)
MLDLSDKGDLEPTYRQAPHNVEAEQALLGAILVNNEAFYRVSDFLEPRHFYEPIHARVFE
LASALIRAGKLATPVTIKTFLPADLDVAGLTGPQYLARLAAEATTVINSEDYGRTIYDLS
VRRDLIRIGEEIVNEAYDAPVDATPQDQIEEAEKRLYEIAETGRYDGGFQRFGEALRESV
DMASKAFQRDGHLSGIATALDDLDHQMGGLQPSDLVILAGRPAMGKTSLATNIAFNIAAA
YRGETRPDGSTETVSGGVVGFFSLEMSAEQLATRILAEQAEIASYKIRRGDISESEFSKL
AAAAQTMQTIPLYIDDTGGISIAQLVARARRLKRQRGLDFMVIDYLQLLSGSSKASSQNR
VQEITEITTGLKALAKELQVPVMALSQLSRQVEARDDKRPQLSDLRESGSIEQDADVVMF
VYREEYYLKSKEPKPGTEEWFKWEIEMKAAENTAEIIIGKQRHGPTGTVKVHFEPQFTRF
SNLAREDHLPDRH