Protein Info for GFF1866 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: periplasmic sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details PF00672: HAMP" amino acids 136 to 186 (51 residues), 40.5 bits, see alignment 4.2e-14 PF00512: HisKA" amino acids 194 to 251 (58 residues), 42.6 bits, see alignment E=7.6e-15 PF02518: HATPase_c" amino acids 298 to 416 (119 residues), 94.5 bits, see alignment E=8.6e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF1866 periplasmic sensor signal transduction histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSLFGSRLYIRIWLAVVAAVTVLTLVTGWLWQQALDEDRAEREARVTRTIIVRDGAREI
VGQAPARAVSIPGEGWEFEVEMKDGQTLYVLLPRPNRPSGGNNAGRRAPDWFQTPTGFAW
LLGLVAFAVALGAYPIVRRLTKRLEALQKGVERWGDGDLSTRLPMQGQDEVAFLATRFNA
AAERVQTLLQSHKALLANASHELRSPLARIRMGLELLGTDSARAAQRAEIARSIEELDQL
IDEILLASRLDLIDARDASALGPTEEVDLVGLAAEECARTGADLEIAAGTAPVLVHGQAR
LLRRVLRNLLENARRYGHVGAGGDSQVRLSIHAPTSVLGQETPRVALWVEDRGPGVPPEQ
RARIFEPFYRLPGASEREGGVGLGLSLVKTIIERHGGRVRCEDRPGGGARFVVELPV