Protein Info for GFF1856 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 975 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 187 to 208 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 334 to 359 (26 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 53 to 174 (122 residues), 24.6 bits, see alignment E=5.5e-09 PF00989: PAS" amino acids 410 to 516 (107 residues), 27.4 bits, see alignment E=7.3e-10 TIGR00229: PAS domain S-box protein" amino acids 412 to 526 (115 residues), 28.4 bits, see alignment E=1.5e-10 PF08447: PAS_3" amino acids 425 to 512 (88 residues), 53.6 bits, see alignment E=5.4e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 528 to 691 (164 residues), 94.7 bits, see alignment E=5.2e-31 PF00990: GGDEF" amino acids 530 to 687 (158 residues), 117.7 bits, see alignment E=1.1e-37 PF00563: EAL" amino acids 708 to 948 (241 residues), 209.6 bits, see alignment E=1.1e-65

Best Hits

KEGG orthology group: None (inferred from 80% identity to azc:AZC_0489)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (975 amino acids)

>GFF1856 hypothetical protein (Xanthobacter sp. DMC5)
LRSFLTGVLALPVALLLMLCALTGSAQAMEAIALRLDAKVVDLLPAVERQTTEDGRYQIS
TAPDAEGVVRRIEVPTSDGRSHGEWIAFALTNNTDEQVDRLIVAPHYRMSGSGLFWPDLG
NRRILSLTPSQGFKPERQSAPDADVFLITLDPGSTVTFVVELGSPNLPQLQLWEPDAYKD
RVNAFTLYHGIVIGIAGLLALFLTILFVVKGSVMFPAAAALAWAVLGYIGLDFAFWSKVF
GLSPIAEQFWRAAGEAILTATLLVFLFAYLNLNRWHVRYVHVAAGWLVFLAALVVVALLD
APVAAGIARLSLLAVAVAGFGVVIWLSQHGFDRAVLIIPTWSLLVVWVLMAGLTVAGFVT
NDLAAPALSGGLVLIVMLIGFTVMQHAFAGIGGIQGSTSELERRALALAGSGLIVWDWDV
DTDRIYTSPEAEEALGLKRHSLETEAAGWLEVLHPADRDRFRATLDGIIDQRRGRIDQDF
RLRAIDGHYLTFNLKARPVVGADGEVVRCIGTLTDVTGERIAAERLLHDAVRDNLTGLPN
RELFLDRLHQALVTARLDDKVKPTVMVIDLDRFKQLNVQVGMAVADSILLTVARRMTRLL
KPQDTLARISGDQFGIILMSERDAERITTFADTLRRSLRAPIAFADREVFVTASIGLVLS
GPDQVKRDEVLKDAELAMYYAKRIGGDRIEVFRPAMRQQKIDRVVLEQELREALEKEQIS
VRYQPIVRLGDRAIGGFEAYMRWNHPRLGELAASEFILLAEETGLILDLGLFVLDRAARQ
LGQWQRLLRVDPPLFMHVNVSSRQLLRHDLIQDLKSVLARNTVAPGSLKLEVTESLVMEN
PEYAAVVLGRMRELGAGLCLDDFGTGYSSLAYLQRFPFDSVKIDPRFVRSVAKGPSRAAR
PVIVGAMIDLAHDLGMDVMAEGLEKETEATEMTRFGCEYGQGVVFGEPLTAEECRHLIEP
APAETRKKKTSTAAE