Protein Info for GFF1854 in Xanthobacter sp. DMC5

Annotation: Gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF01266: DAO" amino acids 36 to 388 (353 residues), 185.7 bits, see alignment E=1.9e-58 PF13450: NAD_binding_8" amino acids 39 to 68 (30 residues), 22.6 bits, see alignment (E = 1e-08)

Best Hits

KEGG orthology group: None (inferred from 68% identity to xau:Xaut_2412)

MetaCyc: 40% identical to pipecolate oxidase (Pseudomonas putida)
L-pipecolate oxidase. [EC: 1.5.3.7]

Predicted SEED Role

"L-pipecolate oxidase (1.5.3.7)" in subsystem Lysine degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>GFF1854 Gamma-glutamylputrescine oxidoreductase (Xanthobacter sp. DMC5)
MPPAPGTDPKSHGLWAMTAPPPPETAPLTGAARAADVAVVGAGYTGLAAALRLAEAGARV
TLLEAAGIGSGGAGRNVGLVNAGLWVMPDDIVATLGVERGEGLLSLLGGAPAEVFALVAR
HAIACEATPNGTLHCAVGRAGRAEIEARAAQWQARGAPVHLLDAEKARTMIGGGSYRGAL
LDDRAGTIQPLAYARGLARAAMGAGAVIHTASPVRAAEAGAGGWLLRTDGGTLAADWIIV
AGDAYSFGPWERLAREQVPLPYFNFATPPVPEALRQRILPGRPGIWDTQQVLTSLRYDAA
GRLVFGSIGALAGIEAGVHAAYARRALARLFPELPPAPFEAGWFGTIGMTDDALPRFRRL
ARNVVSISGYNGRGIGPGTVFGRLLADLVLGRVRPEEVPLPERDVTVPRWRAAKAAFYAA
GSAAAHLVGERRPA