Protein Info for PS417_09430 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF12697: Abhydrolase_6" amino acids 28 to 282 (255 residues), 50.9 bits, see alignment E=5.2e-17 PF00561: Abhydrolase_1" amino acids 28 to 175 (148 residues), 94.7 bits, see alignment E=1.2e-30 PF12146: Hydrolase_4" amino acids 29 to 138 (110 residues), 28.1 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 43% identical to DEH1_MORSB: Haloacetate dehalogenase H-1 (dehH1) from Moraxella sp. (strain B)

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 96% identity to pfs:PFLU2052)

MetaCyc: 43% identical to fluoroacetate dehalogenase monomer (Moraxella sp. B)
Haloacetate dehalogenase. [EC: 3.8.1.3]

Predicted SEED Role

"Haloacetate dehalogenase H-1 (EC 3.8.1.3)" (EC 3.8.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1V9 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PS417_09430 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MFAGFQKDQCHVNGVDISYRQGGTGPGLLLLHGHPQTHVIWHKVAEQLAEHFTVVAADLR
GYGDSSKPPANDDHSNYSKREMARDSAELMKALGFAQFSVLAHDRGARVAHRLALDHPAA
VQRMVLLDIAPTLSMYAQTDEAFARAYWHWFFLIRPAPLPEALIESNPELYLRSVMGSRS
AGLKPFTDEAFAEYLRCLKLPGAATGLCEDYRAAAGIDLEHDQADIDAGNHLNLPLLVMW
GAEGTVGRCFEPLKEWQKVATDVRGKALPAGHYIAEEAPELLLGEVLTFLR