Protein Info for PS417_09425 in Pseudomonas simiae WCS417

Annotation: C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 347 to 375 (29 residues), see Phobius details amino acids 387 to 403 (17 residues), see Phobius details PF00375: SDF" amino acids 10 to 403 (394 residues), 354.9 bits, see alignment E=2.9e-110

Best Hits

Swiss-Prot: 69% identical to DCTA_CUPTR: C4-dicarboxylate transport protein (dctA) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 81% identity to avn:Avin_09460)

MetaCyc: 55% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9Q9 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PS417_09425 C4-dicarboxylate transporter (Pseudomonas simiae WCS417)
MTIRKLLGTLYIQVLIAIALGVLIGHQWPQIGIDLKPLGDGFIKLIKMIIGPIIFCTVVS
GITSMHDVKQVGRVGGKALLYFEVVSTIALLIGILAAHLLHPGVGFNIDVKTLDSSAIAG
FVGQAEHGEGITGFLLHVIPATFFDAFSKGEILPVLFVSVLFGVGLVMVGEKGRPLVGVI
NQASEVFFRIVGIISRVAPIGAFGAIAFTIGKYGVGSLLPLLKLVGTFYVTAFFFIAVVL
GSIARYAGFSIFKLMGYIKSELLIVLGTSSSESALPQLIQKLESLGASKGVVGIVVPTGY
TFNLDGTNIYMTLAVLFLAQATNIHLPLEQQLTLLAVAMLTSKGAGAVVGAGFVALAASL
AVVPTVPVAAMVLILGVDRFMAECRSLTNIIGNAVAALVVAAWEGELDREKMAPIALKRG
RHARAAEAAAQAKMAAE