Protein Info for GFF1847 in Xanthobacter sp. DMC5

Annotation: Quinolinate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 53 to 346 (294 residues), 300.8 bits, E=5.3e-94
• PF02445: NadA
  • amino acids 55 to 345 (291 residues), 367.5 bits, E=2.4e-114

Best Hits

Swiss-Prot: 76% identical to NADA1_RHILO: Quinolinate synthase A 1 (nadA1) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 86% identity to xau:Xaut_1183)

MetaCyc: 42% identical to quinolinate synthase (Thermotoga maritima)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Protein Sequence (346 amino acids)

>GFF1847 Quinolinate synthase A (Xanthobacter sp. DMC5)
MVVSTLSAVPAARPALQATPEALAEAFARTAPLYEKIRRVVPPADWAFLAEDAEAILRLK
RERNAVILAHNYQTPEIFHCVADIVGDSLALAREAMRVDADVIVLAGVYFMAETAKLLNP
GKTVLIPDQDAGCSLADSITAADVRLMRAAHPGVPVIAYVNTSAAVKAEVDVCCTSGNAA
RVVKSFGVPRVIMLPDQYLAKNVAAETGIDIISWAGQCEVHELFTAADVRELRAANPGVT
VLVHPECPPDVVAEADFAGSTAAMSDYVSEKRPPRVVLLTECSMADNVAVHYPDIDFVRP
CNLCPHMKKITLRNIRAALENNLHEVTIDPEIAARARGSVERMLAL