Protein Info for GFF1847 in Variovorax sp. SCN45

Annotation: Nucleoside ABC transporter, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02608: Bmp" amino acids 58 to 322 (265 residues), 189 bits, see alignment E=5.1e-60

Best Hits

Swiss-Prot: 49% identical to PBP_BRUA2: Purine-binding protein BAB2_0673 (BAB2_0673) from Brucella abortus (strain 2308)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 93% identity to vap:Vapar_3900)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF1847 Nucleoside ABC transporter, substrate-binding protein (Variovorax sp. SCN45)
MNDLNKRSLLKLAAFTAVASAALIGCGKKEEAAAPAAAPAAPAPVAAAPAPATAAPLNIA
FAYVGPVGDGGWSFAHDNARKALEKEFGDKIKTTFVESVPEGADAERVFRDFVSQGNKLI
FGTTFGYMEPMLKVAADNKDVKFEHATGYKTSENMRTYDSRTYEGAYMAGVIAGAMTKSN
TLGVVGSVPIPEVLRNINSFTLGAQSVNPKITTKVVWVNEWFSPPKETEAATALINGGAD
VLFQNTDSPAVLKTAQEKGKRAFGWDSDMTAYGPKAHLASAVINWTPYYVKATQEALDGK
WTTGQAWWGVKEGAIDLVSIAEDVPAEAKAKVDEVKKGLKDGSFVIWKGPILGQDGKELV
AKDAVADDKFLSGINFYVKGVEGKVPGGDKK