Protein Info for GFF1845 in Variovorax sp. SCN45

Annotation: Nucleoside ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 336 (277 residues), 130.9 bits, see alignment E=2.5e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 93% identity to vpe:Varpa_4509)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF1845 Nucleoside ABC transporter, permease protein 1 (Variovorax sp. SCN45)
MLKLEPRPELSRFWSYASPILALLITVLIGVALFAALGKDPVKGLLVFFYEPIKNGYAIG
ELMVKATPLLIIALGLAVCFRSNVWNIGAEGQFVFGAIAAGGVALLADKTTGQWIVVAIL
AAGILGGMVWAGIVAFLRDKCNANEILVSLMLVYVATLLLGYMVFGPWKDPNGYNFPQTK
TFEAVTQIPRLFKGSRVSIGLVIALVGAGALWVFLFRTRAGFAQQVGGLAPAASRYAGFS
ARRAVWIALLTSGGAAGLAGALEVAGPLGQLTPYVPAGYGFAAIIVAFVGRLHPVGMIFS
AILMSMFYIGGELAQSRLGLPKSLTGVFQGLLLFTLLACDTLIAYRIRRKAAAKAAAAGM
TTASLQASTPITAPVARPTEGAL