Protein Info for GFF1844 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glycerol-3-phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details TIGR00712: glycerol-3-phosphate transporter" amino acids 1 to 440 (440 residues), 891 bits, see alignment E=1.7e-272 PF07690: MFS_1" amino acids 34 to 399 (366 residues), 166.1 bits, see alignment E=5.5e-53 TIGR00881: phosphoglycerate transporter family protein" amino acids 35 to 417 (383 residues), 557.6 bits, see alignment E=1.4e-171

Best Hits

Swiss-Prot: 97% identical to GLPT_ECOLI: Glycerol-3-phosphate transporter (glpT) from Escherichia coli (strain K12)

KEGG orthology group: K02445, MFS transporter, OPA family, glycerol-3-phosphate transporter (inferred from 99% identity to sty:STY2512)

MetaCyc: 97% identical to sn-glycerol 3-phosphate:phosphate antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-22

Predicted SEED Role

"Glycerol-3-phosphate transporter" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>GFF1844 Glycerol-3-phosphate transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLSIFKPAPHKARLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVRKNFALAMPYLVEQGF
SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSI
AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGM
AWFNDWKAALYMPAFGAIVVALFAFAMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEEELT
AKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEY
AGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPNVDMACMIIIGFL
IYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVM
IGGSILAVILLVVVMIGEKRHHDELQLKRNGG