Protein Info for GFF1842 in Xanthobacter sp. DMC5

Annotation: Cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 87 to 113 (27 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 180 (172 residues), 98.2 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 76% identity to xau:Xaut_1186)

Predicted SEED Role

"cytochrome b561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>GFF1842 Cytochrome b561 (Xanthobacter sp. DMC5)
MPVDTSLTRYGPALRALHWLTAIAVFTAFGVTYLEAFFARGTPARGMVWWVHISVGLLLI
ALLAVRIPVRIFGRNPPASAQISRPVAIASHIVHGLLYLALIATLALGVYLAFLRGNAVS
FFSLFTIPSPIAVNRDLGKQVQEIHELMANAVIILAVLHAAAAVLHHVVLKDDVLKRMLP
ERLAP