Protein Info for PS417_09350 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 72 to 272 (201 residues), 53.9 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to pfs:PFLU2037)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4E8 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PS417_09350 ABC transporter permease (Pseudomonas simiae WCS417)
MIRGKWLALLCLVPFALFFIVFEIAPLVWVLINSLQTEEAGWGLENFTRIFSSKFYLQAI
QFSLEISFYSSIFGIIIATLGSYSLRRVDSPLRNFVTAFANMTSNFAGVPLAFAFIILLG
FNGSITIMLKQAGIIQDFNLYSKTGLIILYTYFQIPLGVLLLYPAFDALREDWRESASLL
GANGWQFWRHIGLPVLTPALLGTFVILLANALGAYATVYALTTGNFNVLPIRIAGLVSGD
VSLDPYLASALAVVLVALMTVVTVVHQLLLKRSYHVSR