Protein Info for GFF1838 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF04321: RmlD_sub_bind" amino acids 1 to 298 (298 residues), 353.1 bits, see alignment E=2.1e-109 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 297 (296 residues), 330.4 bits, see alignment E=3.9e-103 PF01370: Epimerase" amino acids 3 to 181 (179 residues), 72.7 bits, see alignment E=6.6e-24 PF16363: GDP_Man_Dehyd" amino acids 41 to 144 (104 residues), 48.6 bits, see alignment E=1.7e-16 PF02719: Polysacc_synt_2" amino acids 41 to 164 (124 residues), 25 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 59% identical to RMLD_ECOLI: dTDP-4-dehydrorhamnose reductase (rfbD) from Escherichia coli (strain K12)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 72% identity to lch:Lcho_0620)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF1838 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKILLLGKNGQIGWELQRSLAPLGELVALDRHSTPAEGGPGDLADPESLRETVQRLRPDV
IVNAAAHTAVDRAESEPELARTVNTLAPGALAAAAHAVGALLVHYSTDYVFDGSGDAPWR
EDAATAPLSVYGTTKRDGEDLIRASGARHLILRTSWVYAARGGNFARTMLRLAQEREHLT
VIDDQWGAPTGAELIADVTAHAVRQVLREPACTGTYHLSAAGETSWHGYARFVLDTARAL
KPGLALKAQEVAPVPSGAFPTAARRPLNSRLDTARLRERFGLTLPHWQSGVRRMLAEIL